PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400028305
Common NameLOC102605771
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 239aa    MW: 27170.5 Da    PI: 5.2791
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400028305genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF90.11.1e-28959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          k+i+n++ rqvtfskRr g++KKAeELSvLCda+va+iifsstgkl++y++
  PGSC0003DMP400028305  9 KKIDNSTARQVTFSKRRRGLFKKAEELSVLCDADVALIIFSSTGKLFDYCN 59
                          68***********************************************85 PP

2K-box52.62e-189117318100
                 K-box  18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                           + ++++L kei++  + +R++ Ge+L+ L++++LqqLe+ Le++l+++ ++K + ++++i++lq+k  +l een++Lr++l+e
  PGSC0003DMP400028305  91 NSNYSRLSKEISEKSHRLRQMRGEELQGLNIEDLQQLERSLETGLSRVIERKGDKIMREINQLQQKGMQLMEENEKLRQQLME 173
                           46799***************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.3E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.997161IPR002100Transcription factor, MADS-box
CDDcd002654.08E-40277No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-27323IPR002100Transcription factor, MADS-box
SuperFamilySSF554557.06E-31375IPR002100Transcription factor, MADS-box
PfamPF003197.0E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129714.06687177IPR002487Transcription factor, K-box
PfamPF014869.6E-1792171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009910Biological Processnegative regulation of flower development
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0030154Biological Processcell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048438Biological Processfloral whorl development
GO:0005634Cellular Componentnucleus
GO:0000900Molecular Functiontranslation repressor activity, nucleic acid binding
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MAREKIQIKK IDNSTARQVT FSKRRRGLFK KAEELSVLCD ADVALIIFSS TGKLFDYCNS  60
SMKQILERRD LHSKNLEKLD QPSLELQLVE NSNYSRLSKE ISEKSHRLRQ MRGEELQGLN  120
IEDLQQLERS LETGLSRVIE RKGDKIMREI NQLQQKGMQL MEENEKLRQQ LMEISNNNNN  180
GYKEPVVVAF ESENGFNSNN EEGQSSESVT NPCNSTGPPP QDDDSSDISL KLGLPYSG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-18166166Myocyte-specific enhancer factor 2B
1tqe_Q2e-18166166Myocyte-specific enhancer factor 2B
1tqe_R2e-18166166Myocyte-specific enhancer factor 2B
1tqe_S2e-18166166Myocyte-specific enhancer factor 2B
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00272DAPTransfer from AT2G22540Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6986610.0JQ698661.1 Capsicum annuum cultivar Maor jointless mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006353175.11e-173PREDICTED: MADS-box protein JOINTLESS isoform X1
SwissprotQ9FUY61e-146JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBLM1BBZ01e-173M1BBZ0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000417731e-172(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9382377
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-105MIKC_MADS family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]